PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.26833s0441.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family ARR-B
Protein Properties Length: 300aa    MW: 33695.6 Da    PI: 6.9026
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.26833s0441.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like65.21.2e-20194245255
               G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           +r++Wt  LH++Fvea+++LG  ekA P +i  lm+v+gL + +v+SHLQkY+l
  Bostr.26833s0441.1.p 194 KRVVWT--LHKKFVEAIQELGSGEKASPEQIHALMNVEGLPMINVASHLQKYKL 245
                           699998..9*******************************************86 PP

2Response_reg66.11.6e-22201271109
                           EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHH CS
          Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedal 87 
                           +l vdD+p+ ++ l+++l   +y +v+ ++d+++a el +ek   +Dl+++D+emp+ dG++ll+     +++lp+i+++ah++ + ++
  Bostr.26833s0441.1.p  20 ILFVDDNPICLQTLEELLLCCKY-HVTKTTDSKKAQELQREKSnmFDLVITDVEMPETDGFKLLEIGL--AMNLPVIILSAHSDYDSVK 105
                           799********************.999999999999988888789******************97533..358**************** PP

                           HHHHTTESEEEESS--HHHHHH CS
          Response_reg  88 ealkaGakdflsKpfdpeelvk 109
                           + +  Ga d+l+Kp+  +el++
  Bostr.26833s0441.1.p 106 KSITHGACDYLVKPVGLKELHN 127
                           *******************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.71E-2917135IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.3E-3217169No hitNo description
SMARTSM004483.5E-2218129IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011036.31819133IPR001789Signal transduction response regulator, receiver domain
PfamPF000729.4E-2120128IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.49E-2321132No hitNo description
SuperFamilySSF466891.97E-9192249IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.0E-19192249IPR009057Homeodomain-like
TIGRFAMsTIGR015574.1E-17194245IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MELRSTEEGR REQFTVGMRI LFVDDNPICL QTLEELLLCC KYHVTKTTDS KKAQELQREK  60
SNMFDLVITD VEMPETDGFK LLEIGLAMNL PVIILSAHSD YDSVKKSITH GACDYLVKPV  120
GLKELHNIWR HVVKKNIISS YAKNIGPSLQ LLPPYESHLV PNFSKKQNED DSDRREEDGE  180
GNEHNGKESC ARMKRVVWTL HKKFVEAIQE LGSGEKASPE QIHALMNVEG LPMINVASHL  240
QKYKLCLKKL TEAQQLNMAQ LNGLGNFNAK TTAKLGNLIA SPSPQPSSHR AFIDESSKD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002866248.11e-106predicted protein
SwissprotQ9FGT71e-97ARR18_ARATH; Two-component response regulator ARR18
TrEMBLD7MPK51e-106D7MPK5_ARALL; Predicted protein
STRINGAl_scaffold_0008_22761e-106(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2719123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58080.15e-86response regulator 18